Recombinant Human Kit ligand protein(KITLG), partial (Active)
Catalog Number:
CSB-AP002061HU
- Images (0)
| Article Name: | Recombinant Human Kit ligand protein(KITLG), partial (Active) |
| Biozol Catalog Number: | CSB-AP002061HU |
| Supplier Catalog Number: | CSB-AP002061HU |
| Alternative Catalog Number: | CSB-AP002061HU-500, CSB-AP002061HU-100, CSB-AP002061HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Mast cell growth factor, Stem cell factor, SCF, c-Kit ligand, |
| Molecular Weight: | 18.5 kDa |
| Tag: | Tag-Free |
| UniProt: | P21583 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Source: | E.Coli |
| Expression System: | 26-189aa |
| Purity: | >97% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA |
Product Guarantee and Expert Support
