Recombinant Human Glial cell line-derived neurotrophic factor protein(GDNF) (Active)
Catalog Number:
CSB-AP002881HU
- Images (0)
| Article Name: | Recombinant Human Glial cell line-derived neurotrophic factor protein(GDNF) (Active) |
| Biozol Catalog Number: | CSB-AP002881HU |
| Supplier Catalog Number: | CSB-AP002881HU |
| Alternative Catalog Number: | CSB-AP002881HU-500, CSB-AP002881HU-100, CSB-AP002881HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | hGDNF, ATF |
| Molecular Weight: | 15.1 kDa |
| Tag: | Tag-Free |
| UniProt: | P39905 |
| Buffer: | Lyophilized from a 0.2 µm filtered 1 * PBS, pH 7.4, with 0.05 % Tween-20 |
| Source: | E.Coli |
| Expression System: | 78-211aa |
| Purity: | >97% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
Product Guarantee and Expert Support
