Recombinant Human Platelet-derived growth factor subunit B(PDGFB) (Active)
Catalog Number:
CSB-AP003821HU
- Images (0)
| Article Name: | Recombinant Human Platelet-derived growth factor subunit B(PDGFB) (Active) |
| Biozol Catalog Number: | CSB-AP003821HU |
| Supplier Catalog Number: | CSB-AP003821HU |
| Alternative Catalog Number: | CSB-AP003821HU-1, CSB-AP003821HU-500, CSB-AP003821HU-50, CSB-AP003821HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Platelet-Derived Growth Factor Subunit B, PDGF Subunit B, PDGF-2, Platelet-Derived Growth Factor B Chain, Platelet-Derived Growth Factor Beta Polypeptide, Proto-Oncogene c-Sis, Becaplermin, PDGFB, PDGF2, SIS |
| Molecular Weight: | 12.42 kDa |
| Tag: | Tag-Free |
| UniProt: | P01127 |
| Buffer: | Lyophilized from a 0.2 µm filtered solution of 20mM NaAc-HAc, pH 4.5. |
| Source: | E.coli |
| Expression System: | 82-190aa |
| Purity: | Greater than 98% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
Product Guarantee and Expert Support
