Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active)
Catalog Number:
CSB-AP003861HU
Article Name: |
Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active) |
Biozol Catalog Number: |
CSB-AP003861HU |
Supplier Catalog Number: |
CSB-AP003861HU |
Alternative Catalog Number: |
CSB-AP003861HU-1,CSB-AP003861HU-500,CSB-AP003861HU-50,CSB-AP003861HU-10 |
Manufacturer: |
Cusabio |
Category: |
Proteine/Peptide |
Alternative Names: |
Transforming Growth Factor Beta-1, TGF-Beta-1, Latency-Associated Peptide, LAP, TGFB1, TGFB |
Molecular Weight: |
12.8 kDa |
Tag: |
Tag-Free |
UniProt: |
P01137 |
Buffer: |
Lyophilized from a 0.2 µm filtered 50mM Glycine-HCl, 150mMNacl, pH2.5 |
Source: |
Mammalian cell |
Expression System: |
279-390aa |
Purity: |
Greater than 95% as determined by SDS-PAGE. |
Form: |
Lyophilized powder |
Sequence: |
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |