Recombinant Human Thrombopoietin (THPO) (Active)
Catalog Number:
CSB-AP003971HU
Article Name: |
Recombinant Human Thrombopoietin (THPO) (Active) |
Biozol Catalog Number: |
CSB-AP003971HU |
Supplier Catalog Number: |
CSB-AP003971HU |
Alternative Catalog Number: |
CSB-AP003971HU-1,CSB-AP003971HU-500,CSB-AP003971HU-50,CSB-AP003971HU-10 |
Manufacturer: |
Cusabio |
Category: |
Proteine/Peptide |
Alternative Names: |
Thrombopoietin,C-mpl ligand,Megakaryocyte colony-stimulating factor,Megakaryocyte growth and development factor,Myeloproliferative leukemia virus oncogene ligand,THPO |
Molecular Weight: |
37.3 kDa |
Tag: |
N-terminal 6xHis-tagged and C-terminal 6xHis-tagged |
UniProt: |
P40225 |
Buffer: |
Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
Source: |
Mammalian cell |
Expression System: |
22-353aa |
Purity: |
Greater than 95% as determined by SDS-PAGE. |
Form: |
Lyophilized powder |
Sequence: |
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDIS |
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |