Recombinant Human Transforming growth factor beta-3(TGFB3), partial (Active)
Catalog Number:
CSB-AP004051HU
- Images (0)
| Article Name: | Recombinant Human Transforming growth factor beta-3(TGFB3), partial (Active) |
| Biozol Catalog Number: | CSB-AP004051HU |
| Supplier Catalog Number: | CSB-AP004051HU |
| Alternative Catalog Number: | CSB-AP004051HU-1, CSB-AP004051HU-500, CSB-AP004051HU-50, CSB-AP004051HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Transforming growth factor beta-3,TGFB3,TGF-beta-3,Latency-associated peptide,LAP |
| Molecular Weight: | 12.7 kDa |
| Tag: | Tag-Free |
| UniProt: | P10600 |
| Buffer: | Lyophilized from a 0.2 µm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH2.5. |
| Source: | Mammalian cell |
| Expression System: | 301-412aa(Y340F) |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS |
Product Guarantee and Expert Support
