Recombinant Mouse Fibroblast growth factor 2(Fgf2) (Active)
Catalog Number:
CSB-AP004061MO
- Images (0)
| Article Name: | Recombinant Mouse Fibroblast growth factor 2(Fgf2) (Active) |
| Biozol Catalog Number: | CSB-AP004061MO |
| Supplier Catalog Number: | CSB-AP004061MO |
| Alternative Catalog Number: | CSB-AP004061MO-1, CSB-AP004061MO-500, CSB-AP004061MO-50, CSB-AP004061MO-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Fibroblast Growth Factor 2, FGF-2, Basic Fibroblast Growth Factor, bFGF, Heparin-Binding Growth Factor 2, HBGF-2, Fgf2, Fgf-2 |
| Molecular Weight: | 17.15 kDa |
| Tag: | Tag-Free |
| UniProt: | P15655 |
| Buffer: | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 400mM NaCl, 0.02% Tween 80, 4.0% Sucrose, 4.0% Manntiol, pH 7.0 |
| Source: | E.coli |
| Expression System: | 1-154aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Product Guarantee and Expert Support
