Recombinant Mouse Beta-nerve growth factor(Ngf), partial (Active)
Catalog Number:
CSB-AP004081MO
- Images (0)
| Article Name: | Recombinant Mouse Beta-nerve growth factor(Ngf), partial (Active) |
| Biozol Catalog Number: | CSB-AP004081MO |
| Supplier Catalog Number: | CSB-AP004081MO |
| Alternative Catalog Number: | CSB-AP004081MO-1, CSB-AP004081MO-500, CSB-AP004081MO-50, CSB-AP004081MO-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Beta-Nerve Growth Factor, Beta-NGF, NGF, NGFB |
| Molecular Weight: | 12.4 kDa |
| Tag: | Tag-Free |
| UniProt: | P01139 |
| Buffer: | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 200mM NaCl, pH 8.0. |
| Source: | E.coli |
| Expression System: | 130-239aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR |
Product Guarantee and Expert Support
