Recombinant Mouse Interleukin-33(Il33), partial (Active)
Catalog Number:
CSB-AP004251MO
- Images (0)
| Article Name: | Recombinant Mouse Interleukin-33(Il33), partial (Active) |
| Biozol Catalog Number: | CSB-AP004251MO |
| Supplier Catalog Number: | CSB-AP004251MO |
| Alternative Catalog Number: | CSB-AP004251MO-1, CSB-AP004251MO-500, CSB-AP004251MO-50, CSB-AP004251MO-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Interleukin 33, IL-33, IL33, C9orf26, NKHEV, Interleukin-1 family member 11, DVS27, NF-HEV and IL- 1F11 |
| Molecular Weight: | 17.6 kDa |
| Tag: | Tag-Free |
| UniProt: | Q8BVZ5 |
| Buffer: | Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Source: | E.coli |
| Expression System: | 109-266aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
Product Guarantee and Expert Support
