Recombinant Human Interleukin-13 (IL13), partial (Active)
Catalog Number:
CSB-AP004321HU
- Images (0)
| Article Name: | Recombinant Human Interleukin-13 (IL13), partial (Active) |
| Biozol Catalog Number: | CSB-AP004321HU |
| Supplier Catalog Number: | CSB-AP004321HU |
| Alternative Catalog Number: | CSB-AP004321HU-1, CSB-AP004321HU-500, CSB-AP004321HU-50, CSB-AP004321HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Interleukin-13,IL-13, |
| Molecular Weight: | 13.4 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P35225 |
| Buffer: | Lyophilized from a 0.2 µm filtered solution of PBS,PH7.4. |
| Source: | Mammalian cell |
| Expression System: | 35-146aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
Product Guarantee and Expert Support
