Recombinant Mouse Interleukin-17A(Il17a), partial (Active)
Catalog Number:
CSB-AP004781MO
- Images (0)
| Article Name: | Recombinant Mouse Interleukin-17A(Il17a), partial (Active) |
| Biozol Catalog Number: | CSB-AP004781MO |
| Supplier Catalog Number: | CSB-AP004781MO |
| Alternative Catalog Number: | CSB-AP004781MO-1, CSB-AP004781MO-500, CSB-AP004781MO-50, CSB-AP004781MO-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Interleukin-17A, IL-17, IL-17A, Cytotoxic T-Lymphocyte-Associated Antigen 8, CTLA-8, IL17A, CTLA8, IL17 |
| Molecular Weight: | 16.2 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q62386 |
| Buffer: | Lyophilized from a 0.2 µm filtered solution of PBS,PH7.4. |
| Source: | Mammalian cell |
| Expression System: | 22-158aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA |
Product Guarantee and Expert Support
