Recombinant Mouse Interleukin-4(Il4), partial (Active)
Catalog Number:
CSB-AP004811MO
- Images (0)
| Article Name: | Recombinant Mouse Interleukin-4(Il4), partial (Active) |
| Biozol Catalog Number: | CSB-AP004811MO |
| Supplier Catalog Number: | CSB-AP004811MO |
| Alternative Catalog Number: | CSB-AP004811MO-1, CSB-AP004811MO-500, CSB-AP004811MO-50, CSB-AP004811MO-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Interleukin-4,B-cell IgG differentiation factor,B-cell growth factor 1,B-cell stimulatory factor 1,IGG1 induction factor,Lymphocyte stimulatory factor 1,IL-4,BSF-1 |
| Molecular Weight: | 13.4 kDa |
| Tag: | Tag-Free |
| UniProt: | P07750 |
| Buffer: | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 300mM NaCl, 5% Trehalose, pH 6.5. |
| Source: | E.coli |
| Expression System: | 23-140aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
Product Guarantee and Expert Support
