Recombinant Human Tumor necrosis factor ligand superfamily member 11(TNFSF11), partial (Active)
Catalog Number:
CSB-AP004851HU
- Images (0)
| Article Name: | Recombinant Human Tumor necrosis factor ligand superfamily member 11(TNFSF11), partial (Active) |
| Biozol Catalog Number: | CSB-AP004851HU |
| Supplier Catalog Number: | CSB-AP004851HU |
| Alternative Catalog Number: | CSB-AP004851HU-1, CSB-AP004851HU-500, CSB-AP004851HU-50, CSB-AP004851HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | CD254, ODF, OPGL, RANK L, TNFSF11, CD254, Osteoclast differentiation factor, Receptor activator of nuclear factor kappa-B ligand, tumor necrosis factor ligand superfamily member 11 |
| Molecular Weight: | 22.4 kDa |
| Tag: | Tag free |
| UniProt: | O14788 |
| Buffer: | Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
| Source: | E.coli |
| Expression System: | 140-317aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID |
Product Guarantee and Expert Support
