Recombinant Human Tumor necrosis factor receptor superfamily member 10C(TNFRSF10C), partial (Active)
Catalog Number:
CSB-AP004961HU
- Images (0)
| Article Name: | Recombinant Human Tumor necrosis factor receptor superfamily member 10C(TNFRSF10C), partial (Active) |
| Biozol Catalog Number: | CSB-AP004961HU |
| Supplier Catalog Number: | CSB-AP004961HU |
| Alternative Catalog Number: | CSB-AP004961HU-1, CSB-AP004961HU-500, CSB-AP004961HU-50, CSB-AP004961HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Tumor Necrosis Factor Receptor Superfamily Member 10C, Antagonist Decoy Receptor for TRAIL/Apo-2L, Decoy TRAIL Receptor Without Death Domain, Decoy Receptor 1, DcR1, Lymphocyte Inhibitor of TRAIL, TNF-Related Apoptosis-Inducing Ligand Receptor 3, TRAIL R |
| Molecular Weight: | 21.78 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | O14798 |
| Buffer: | Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
| Source: | Mammalian cell |
| Expression System: | 26-221aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA |
Product Guarantee and Expert Support
