Recombinant Human Growth/differentiation factor 7 (GDF7)
Catalog Number:
CSB-AP005961HU
- Images (0)
| Article Name: | Recombinant Human Growth/differentiation factor 7 (GDF7) |
| Biozol Catalog Number: | CSB-AP005961HU |
| Supplier Catalog Number: | CSB-AP005961HU |
| Alternative Catalog Number: | CSB-AP005961HU-500, CSB-AP005961HU-100, CSB-AP005961HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | GDF-7, BMP12 |
| Molecular Weight: | 14.0 kDa |
| Tag: | Tag-Free |
| UniProt: | Q7Z4P5 |
| Buffer: | Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
| Source: | E.Coli |
| Expression System: | 322-450aa |
| Purity: | >95% as determined by SDS-PAGE and HPLC analyses. |
| Form: | Lyophilized powder |
| Sequence: | TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR |
Product Guarantee and Expert Support
