Recombinant Human Growth/differentiation factor 6 (GDF6)
Catalog Number:
CSB-AP005971HU
- Images (0)
| Article Name: | Recombinant Human Growth/differentiation factor 6 (GDF6) |
| Biozol Catalog Number: | CSB-AP005971HU |
| Supplier Catalog Number: | CSB-AP005971HU |
| Alternative Catalog Number: | CSB-AP005971HU-500, CSB-AP005971HU-100, CSB-AP005971HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | BMP13, GDF16, GDF-6, BMP-13 |
| Molecular Weight: | 13.6 kDa |
| Tag: | Tag-Free |
| UniProt: | Q6KF10 |
| Buffer: | Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
| Source: | E.Coli |
| Expression System: | 336-455aa |
| Purity: | >95% as determined by SDS-PAGE and HPLC analyses. |
| Form: | Lyophilized powder |
| Sequence: | TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR |
Product Guarantee and Expert Support
