Recombinant Human Growth/differentiation factor 5 (GDF5)
Catalog Number:
CSB-AP005981HU
Article Name: |
Recombinant Human Growth/differentiation factor 5 (GDF5) |
Biozol Catalog Number: |
CSB-AP005981HU |
Supplier Catalog Number: |
CSB-AP005981HU |
Alternative Catalog Number: |
CSB-AP005981HU-500, CSB-AP005981HU-100, CSB-AP005981HU-10 |
Manufacturer: |
Cusabio |
Category: |
Proteine/Peptide |
Alternative Names: |
BMP14, CDMP1, GDF-5, BMP-14, CDMP-1, LAP-4, LPS-associated protein 4, Radotermin |
Molecular Weight: |
13.6 kDa |
Tag: |
Tag-Free |
UniProt: |
P43026 |
Buffer: |
Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
Source: |
E.Coli |
Expression System: |
382-501aa |
Purity: |
>95% as determined by SDS-PAGE and HPLC analyses. |
Form: |
Lyophilized powder |
Sequence: |
APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |