Recombinant Human Growth/differentiation factor 5 (GDF5)
Catalog Number:
CSB-AP005981HU
- Images (0)
| Article Name: | Recombinant Human Growth/differentiation factor 5 (GDF5) |
| Biozol Catalog Number: | CSB-AP005981HU |
| Supplier Catalog Number: | CSB-AP005981HU |
| Alternative Catalog Number: | CSB-AP005981HU-500, CSB-AP005981HU-100, CSB-AP005981HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | BMP14, CDMP1, GDF-5, BMP-14, CDMP-1, LAP-4, LPS-associated protein 4, Radotermin |
| Molecular Weight: | 13.6 kDa |
| Tag: | Tag-Free |
| UniProt: | P43026 |
| Buffer: | Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
| Source: | E.Coli |
| Expression System: | 382-501aa |
| Purity: | >95% as determined by SDS-PAGE and HPLC analyses. |
| Form: | Lyophilized powder |
| Sequence: | APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
Product Guarantee and Expert Support
