Recombinant Bos taurus Albumin (ALB)
Catalog Number:
CSB-BP001561BO
- Images (0)
| Article Name: | Recombinant Bos taurus Albumin (ALB) |
| Biozol Catalog Number: | CSB-BP001561BO |
| Supplier Catalog Number: | CSB-BP001561BO |
| Alternative Catalog Number: | CSB-BP001561BO-1, CSB-BP001561BO-100, CSB-BP001561BO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (BSA)(allergen Bos d 6),CSB-PR2024 |
| Molecular Weight: | 67.7 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P02769 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 25-607aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | DTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECAD |
Product Guarantee and Expert Support
