Recombinant Mouse Serum albumin (Alb)
Catalog Number:
CSB-BP001561MO
- Images (0)
| Article Name: | Recombinant Mouse Serum albumin (Alb) |
| Biozol Catalog Number: | CSB-BP001561MO |
| Supplier Catalog Number: | CSB-BP001561MO |
| Alternative Catalog Number: | CSB-BP001561MO-1, CSB-BP001561MO-100, CSB-BP001561MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Alb 1, alb, ALBU_MOUSE, Albumin 1, Albumin, Serum albumin |
| Molecular Weight: | 67.9 kDa |
| Tag: | C-terminal 9xHis-tagged |
| UniProt: | P07724 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 25-608aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | EAHKSEIAHRYNDLGEQHFKGLVLIAFSQYLQKCSYDEHAKLVQEVTDFAKTCVADESAANCDKSLHTLFGDKLCAIPNLRENYGELADCCTKQEPERNECFLQHKDDNPSLPPFERPEAEAMCTSFKENPTTFMGHYLHEVARRHPYFYAPELLYYAEQYNEILTQCCAEADKESCLTPKLDGVKEKALVSSVRQRMKCSSMQKFGERAFKAWAVARLSQTFPNADFAEITKLATDLTKVNKECCHGDLLECA |
Product Guarantee and Expert Support
