Recombinant Mouse Fructose-bisphosphate aldolase C (Aldoc)
Catalog Number:
CSB-BP001587MO
- Images (0)
| Article Name: | Recombinant Mouse Fructose-bisphosphate aldolase C (Aldoc) |
| Biozol Catalog Number: | CSB-BP001587MO |
| Supplier Catalog Number: | CSB-BP001587MO |
| Alternative Catalog Number: | CSB-BP001587MO-1, CSB-BP001587MO-100, CSB-BP001587MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Aldolase 3,Brain-type aldolase,Scrapie-responsive protein 2,Zebrin II,CSB-PR2024 |
| Molecular Weight: | 40.3 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P05063 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 2-363aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | PHSYPALSAEQKKELSDIALRIVTPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLKISDRTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYSPEEIAMATVT |
Product Guarantee and Expert Support
