Recombinant Macaca fascicularis Apolipoprotein C-III (APOC3)
Catalog Number:
CSB-BP001933MOV
- Images (0)
| Article Name: | Recombinant Macaca fascicularis Apolipoprotein C-III (APOC3) |
| Biozol Catalog Number: | CSB-BP001933MOV |
| Supplier Catalog Number: | CSB-BP001933MOV |
| Alternative Catalog Number: | CSB-BP001933MOV-1, CSB-BP001933MOV-100, CSB-BP001933MOV-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Apolipoprotein C3 |
| Molecular Weight: | 52.7 kDa |
| Tag: | N-terminal MBP-tagged and C-terminal 6xHis-tagged |
| UniProt: | P18659 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 21-99aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA |
Product Guarantee and Expert Support
