Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase (apt)
Catalog Number:
CSB-BP001954SMT
- Images (0)
| Article Name: | Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase (apt) |
| Biozol Catalog Number: | CSB-BP001954SMT |
| Supplier Catalog Number: | CSB-BP001954SMT |
| Alternative Catalog Number: | CSB-BP001954SMT-1, CSB-BP001954SMT-100, CSB-BP001954SMT-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | apt, SPy_0927, M5005_Spy0728Adenine phosphoribosyltransferase, APRT, EC 2.4.2.7,CSB-PR2024 |
| Molecular Weight: | 22.7 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P63546 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 1-172aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG |
Product Guarantee and Expert Support
