Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial

Product Overview

• Article Name: Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial
• Biozol Catalog Number: CSB-BP002058HU1
• Supplier Catalog Number: CSB-BP002058HU1
• Alternative Catalog Number: CSB-BP002058HU1-1, CSB-BP002058HU1-100, CSB-BP002058HU1-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: B120 BRG1-associated factor 250 Short name: BAF250 BRG1-associated factor 250a Short name: BAF250A Osa homolog 1 Short name: hOSA1 SWI-like protein SWI/SNF complex protein p270 SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin su,CSB-PR2024

Product Properties

• Molecular Weight: 32.4 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: O14497
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Baculovirus
• Expression System: 1976-2231aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVD