Recombinant Human Cyclin-dependent kinase4 (CDK4)
Catalog Number:
CSB-BP005065HU
- Images (0)
| Article Name: | Recombinant Human Cyclin-dependent kinase4 (CDK4) |
| Biozol Catalog Number: | CSB-BP005065HU |
| Supplier Catalog Number: | CSB-BP005065HU |
| Alternative Catalog Number: | CSB-BP005065HU-1, CSB-BP005065HU-100, CSB-BP005065HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Cyclin-dependent kinase 4 Cyclin-dependent kinase 4, isoform CRA_c |
| Molecular Weight: | 35.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P11802 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 2-303aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPR |
Product Guarantee and Expert Support
