Recombinant Human Cyclin-dependent kinase 7 (CDK7)
Catalog Number:
CSB-BP005075HU
- Images (0)
| Article Name: | Recombinant Human Cyclin-dependent kinase 7 (CDK7) |
| Biozol Catalog Number: | CSB-BP005075HU |
| Supplier Catalog Number: | CSB-BP005075HU |
| Alternative Catalog Number: | CSB-BP005075HU-1, CSB-BP005075HU-100, CSB-BP005075HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (39 kDa protein kinase)(p39 Mo15)(CDK-activating kinase 1)(Cell division protein kinase 7)(Serine/threonine-protein kinase 1)(TFIIH basal transcription factor complex kinase subunit) |
| Molecular Weight: | 41.5 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P50613 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 1-346aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPG |
Product Guarantee and Expert Support
