Recombinant Human Liver carboxylesterase 1 (CES1)

Product Overview

• Article Name: Recombinant Human Liver carboxylesterase 1 (CES1)
• Biozol Catalog Number: CSB-BP005258HU
• Supplier Catalog Number: CSB-BP005258HU
• Alternative Catalog Number: CSB-BP005258HU-1, CSB-BP005258HU-100, CSB-BP005258HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: (Acyl-coenzyme A:cholesterol acyltransferase)(ACAT)(Brain carboxylesterase hBr1)(Carboxylesterase 1)(CE-1)(hCE-1)(Cholesteryl ester hydrolase)(CEH)(Cocaine carboxylesterase)(Egasyn)(HMSE)(Methylumbelliferyl-acetate deacetylase 1)(Monocyte/macrophage seri

Product Properties

• Molecular Weight: 66.3 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P23141
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Baculovirus
• Expression System: 18-567aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAIT