Recombinant Rat Complement factor I (Cfi)
Catalog Number:
CSB-BP005279RA
- Images (0)
| Article Name: | Recombinant Rat Complement factor I (Cfi) |
| Biozol Catalog Number: | CSB-BP005279RA |
| Supplier Catalog Number: | CSB-BP005279RA |
| Alternative Catalog Number: | CSB-BP005279RA-1, CSB-BP005279RA-100, CSB-BP005279RA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | C3B/C4B inactivator (If),CSB-PR2024 |
| Molecular Weight: | 69.2 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q9WUW3 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 19-604aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | KNTPASGQPQEDLVEQKCLLKNYTHHSCDKVFCQPWQKCIEGTCACKLPYQCPKAGTPVCATNGRGYPTYCHLKSFECLHPEIKFSNNGTCTAEEKFNVSLIYGSTDTEGIVQVKLVDQDEKMFICKNSWSTVEANVACFDLGFPLGVRDIQGRFNIPVNHKINSTECLHVRCQGVETSLAECTFTKKSSKAPHGLAGVVCYTQDADFPTSQSFQCVNGKRIPQEKACDGVNDCGDQSDELCCKGCRGQAFLCK |
Product Guarantee and Expert Support
