Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial

Catalog Number: CSB-BP005389HU1
Article Name: Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial
Biozol Catalog Number: CSB-BP005389HU1
Supplier Catalog Number: CSB-BP005389HU1
Alternative Catalog Number: CSB-BP005389HU1-1, CSB-BP005389HU1-100, CSB-BP005389HU1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: ACHA3_HUMAN, AChR, Cholinergic receptor neuronal nicotinic alpha polypeptide 3, Cholinergic receptor nicotinic alpha 3, Cholinergic receptor nicotinic alpha polypeptide 3, CHRNA 3, CHRNA3, LNCR2, MGC104879, NACHRA 3, NACHRA3, Neuronal acetylcholine recep
Molecular Weight: 26.6 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P32297
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Baculovirus
Expression System: 32-240aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL