Recombinant Human Carboxypeptidase N catalytic chain (CPN1)
Catalog Number:
CSB-BP005898HU
- Images (0)
| Article Name: | Recombinant Human Carboxypeptidase N catalytic chain (CPN1) |
| Biozol Catalog Number: | CSB-BP005898HU |
| Supplier Catalog Number: | CSB-BP005898HU |
| Alternative Catalog Number: | CSB-BP005898HU-1, CSB-BP005898HU-100, CSB-BP005898HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Anaphylatoxin inactivator (Arginine carboxypeptidase) (Carboxypeptidase N polypeptide 1) (Carboxypeptidase N small subunit) (Kininase-1) (Lysine carboxypeptidase) (Plasma carboxypeptidase B) (Serum carboxypeptidase N) (SCPN) (CPN) (ACBP),CSB-PR2024 |
| Molecular Weight: | 56.2 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P15169 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 21-458aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | VTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDY |
Product Guarantee and Expert Support
