Recombinant Mycobacterium tuberculosis Lanosterol 14-alpha demethylase (cyp51)
Catalog Number:
CSB-BP006459MVZ
- Images (0)
| Article Name: | Recombinant Mycobacterium tuberculosis Lanosterol 14-alpha demethylase (cyp51) |
| Biozol Catalog Number: | CSB-BP006459MVZ |
| Supplier Catalog Number: | CSB-BP006459MVZ |
| Alternative Catalog Number: | CSB-BP006459MVZ-1, CSB-BP006459MVZ-100, CSB-BP006459MVZ-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | CYPLI (Cytochrome P450 51) (Cytochrome P450-14DM) (Cytochrome P450-LIA1) (Sterol 14-alpha demethylase) |
| Molecular Weight: | 54.8 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P9WPP8 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 1-451aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSAVALPRVSGGHDEHGHLEEFRTDPIGLMQRVRDECGDVGTFQLAGKQVVLLSGSHANEFFFRAGDDDLDQAKAYPFMTPIFGEGVVFDASPERRKEMLHNAALRGEQMKGHAATIEDQVRRMIADWGEAGEIDLLDFFAELTIYTSSACLIGKKFRDQLDGRFAKLYHELERGTDPLAYVDPYLPIESFRRRDEARNGLVALVADIMNGRIANPPTDKSDRDMLDVLIAVKAETGTPRFSADEITGMFISMM |
Product Guarantee and Expert Support
