Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)

Product Overview

• Article Name: Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)
• Biozol Catalog Number: CSB-BP007399HU
• Supplier Catalog Number: CSB-BP007399HU
• Alternative Catalog Number: CSB-BP007399HU-1, CSB-BP007399HU-100, CSB-BP007399HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: (Developmentally-regulated endothelial cell locus 1 protein)(Integrin-binding protein DEL1),CSB-PR2024

Product Properties

• Molecular Weight: 57.0 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: O43854
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Baculovirus
• Expression System: 24-480aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDN