Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B)
Catalog Number:
CSB-BP007589HU
- Images (0)
| Article Name: | Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B) |
| Biozol Catalog Number: | CSB-BP007589HU |
| Supplier Catalog Number: | CSB-BP007589HU |
| Alternative Catalog Number: | CSB-BP007589HU-1, CSB-BP007589HU-100, CSB-BP007589HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Elastase IIIB (Elastase-3B) (Protease E) (ELA3B),CSB-PR2024 |
| Molecular Weight: | 28.8 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P08861 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 29-270aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH |
Product Guarantee and Expert Support
