Recombinant Rat Ectonucleoside triphosphate diphosphohydrolase 1 (Entpd1), partial
Catalog Number:
CSB-BP007690RA
- Images (0)
| Article Name: | Recombinant Rat Ectonucleoside triphosphate diphosphohydrolase 1 (Entpd1), partial |
| Biozol Catalog Number: | CSB-BP007690RA |
| Supplier Catalog Number: | CSB-BP007690RA |
| Alternative Catalog Number: | CSB-BP007690RA-1, CSB-BP007690RA-100, CSB-BP007690RA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Ecto-ATP diphosphohydrolase 1 (Ecto-ATPDase 1) (Ecto-ATPase 1) (Ecto-apyrase) (Lymphoid cell activation antigen) (CD_antigen: CD39) (NTPDase 1) (Cd39),CSB-PR2024 |
| Molecular Weight: | 50.9 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P97687 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 38-479aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | THNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQLLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLNFISDSQKQATFGALDLGGSSTQVTFVPLNQTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVN |
Product Guarantee and Expert Support
