Recombinant Human Folate receptor beta (FOLR2), partial
Catalog Number:
CSB-BP008786HU1
- Images (0)
| Article Name: | Recombinant Human Folate receptor beta (FOLR2), partial |
| Biozol Catalog Number: | CSB-BP008786HU1 |
| Supplier Catalog Number: | CSB-BP008786HU1 |
| Alternative Catalog Number: | CSB-BP008786HU1-1, CSB-BP008786HU1-100, CSB-BP008786HU1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Folate receptor 2 Folate receptor, fetal/placental Placental folate-binding protein,CSB-PR2024 |
| Molecular Weight: | 27.1 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P14207 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 19-230aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN |
Product Guarantee and Expert Support
