Recombinant Human Formimidoyltransferase-cyclodeaminase (FTCD)

Product Overview

• Article Name: Recombinant Human Formimidoyltransferase-cyclodeaminase (FTCD)
• Biozol Catalog Number: CSB-BP009029HU
• Supplier Catalog Number: CSB-BP009029HU
• Alternative Catalog Number: CSB-BP009029HU-1, CSB-BP009029HU-100, CSB-BP009029HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: Formimidoyltransferase-cyclodeaminase(Formiminotransferase-cyclodeaminase)(FTCD)(LCHC1) [Includes: Glutamate formimidoyltransferase(EC 2.1.2.5)(Glutamate formiminotransferase)(Glutamate formyltransferase), Formimidoyltetrahydrofolate cyclodeaminase(EC 4.,CSB-PR2024

Product Properties

• Molecular Weight: 64.5 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: O95954
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Baculovirus
• Expression System: 1-541aa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETC