Recombinant Rat Sclerostin (Sost)

Catalog Number: CSB-BP859165RA
Article Name: Recombinant Rat Sclerostin (Sost)
Biozol Catalog Number: CSB-BP859165RA
Supplier Catalog Number: CSB-BP859165RA
Alternative Catalog Number: CSB-BP859165RA-1, CSB-BP859165RA-100, CSB-BP859165RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: /,CSB-PR2024
Molecular Weight: 24.9 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q99P67
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Baculovirus
Expression System: 29-213aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY