Recombinant Mouse Complement C1q-like protein 3 (C1ql3)
Catalog Number:
CSB-BP863674MOB1
- Images (0)
| Article Name: | Recombinant Mouse Complement C1q-like protein 3 (C1ql3) |
| Biozol Catalog Number: | CSB-BP863674MOB1 |
| Supplier Catalog Number: | CSB-BP863674MOb1 |
| Alternative Catalog Number: | CSB-BP863674MOB1-1, CSB-BP863674MOB1-100, CSB-BP863674MOB1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | C1q and tumor necrosis factor-related protein 13 (C1q/TNF-related protein 13) (CTRP13) (Gliacolin) (C1ql) (Ctrp13),CSB-PR2024 |
| Molecular Weight: | 28.6 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q9ESN4 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 21-255aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | HYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPVGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD |
Product Guarantee and Expert Support
