Recombinant Human Three-prime repair exonuclease 1 (TREX1)
Catalog Number:
CSB-BP865133HUI2
- Images (0)
| Article Name: | Recombinant Human Three-prime repair exonuclease 1 (TREX1) |
| Biozol Catalog Number: | CSB-BP865133HUI2 |
| Supplier Catalog Number: | CSB-BP865133HUi2 |
| Alternative Catalog Number: | CSB-BP865133HUI2-1, CSB-BP865133HUI2-100, CSB-BP865133HUI2-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 3-5 exonuclease TREX1 Deoxyribonuclease III |
| Molecular Weight: | 83.6 kDa |
| Tag: | N-terminal 10xHis-MBP-tagged and C-terminal 6xHis-tagged |
| UniProt: | Q9NSU2 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 1-369aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MGPGARRQGRIVQGRPEMCFCPPPTPLPPLRILTLGTHTPTPCSSPGSAAGTYPTMGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALESPPTSQGPPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYDFPLLQAELAMLGLTSALDGAFCVDSITALKALERASSPSEHGPRKSYSLGSIYTRLYGQSPPDSHTAEG |
Product Guarantee and Expert Support
