Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3)
Catalog Number:
CSB-BP875360MO
- Images (0)
| Article Name: | Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3) |
| Biozol Catalog Number: | CSB-BP875360MO |
| Supplier Catalog Number: | CSB-BP875360MO |
| Alternative Catalog Number: | CSB-BP875360MO-1, CSB-BP875360MO-100, CSB-BP875360MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3,CSB-PR2024 |
| Molecular Weight: | 26.6 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q9ES30 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 23-246aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK |
Product Guarantee and Expert Support
