Recombinant Human Insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1)
Catalog Number:
CSB-BP878937HU
- Images (0)
| Article Name: | Recombinant Human Insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1) |
| Biozol Catalog Number: | CSB-BP878937HU |
| Supplier Catalog Number: | CSB-BP878937HU |
| Alternative Catalog Number: | CSB-BP878937HU-1, CSB-BP878937HU-100, CSB-BP878937HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (IGF2 mRNA-binding protein 1)(IMP-1)(IMP1)(Coding region determinant-binding protein)(CRD-BP)(IGF-II mRNA-binding protein 1)(VICKZ family member 1)(Zipcode-binding protein 1)(ZBP-1),CSB-PR2024 |
| Molecular Weight: | 69.1 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q9NZI8 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 1-577aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCS |
Product Guarantee and Expert Support
