Recombinant Rattus norvegicus COMM domain-containing protein 5 (Commd5)
Catalog Number:
CSB-BP880645RA
- Images (0)
| Article Name: | Recombinant Rattus norvegicus COMM domain-containing protein 5 (Commd5) |
| Biozol Catalog Number: | CSB-BP880645RA |
| Supplier Catalog Number: | CSB-BP880645RA |
| Alternative Catalog Number: | CSB-BP880645RA-1, CSB-BP880645RA-100, CSB-BP880645RA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Hypertension-related calcium-regulated gene protein |
| Molecular Weight: | 28.2 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q9ERR2 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 2-224aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKKCERKLQD |
Product Guarantee and Expert Support
