Recombinant Mouse Group 10 secretory phospholipase A2 (Pla2g10)
Catalog Number:
CSB-BP882554MO
- Images (0)
| Article Name: | Recombinant Mouse Group 10 secretory phospholipase A2 (Pla2g10) |
| Biozol Catalog Number: | CSB-BP882554MO |
| Supplier Catalog Number: | CSB-BP882554MO |
| Alternative Catalog Number: | CSB-BP882554MO-1, CSB-BP882554MO-100, CSB-BP882554MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Group X secretory phospholipase A2 (GX sPLA2) (sPLA2-X) (Phosphatidylcholine 2-acylhydrolase 10) |
| Molecular Weight: | 17.8 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q9QXX3 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 29-151aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWCCYHHDCCYSRAQDAGCSPKLDRYPWKCMDHHILCGPAENKCQELLCRCDEELAYCLAGTEYHLKYLFFPSILCEKDSPKCN |
Product Guarantee and Expert Support
