Recombinant Human Serine/threonine-protein kinase PAK 5 (PAK5), partial
Catalog Number:
CSB-BP885798HU
- Images (0)
| Article Name: | Recombinant Human Serine/threonine-protein kinase PAK 5 (PAK5), partial |
| Biozol Catalog Number: | CSB-BP885798HU |
| Supplier Catalog Number: | CSB-BP885798HU |
| Alternative Catalog Number: | CSB-BP885798HU-1, CSB-BP885798HU-100, CSB-BP885798HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | p21-activated kinase 5 Short name: PAK-5 p21-activated kinase 7 Short name: PAK-7,CSB-PR2024 |
| Molecular Weight: | 34.9 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8TB93 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 1-293aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSE |
Product Guarantee and Expert Support
