Recombinant Mouse Prion-like protein doppel (Prnd)
Catalog Number:
CSB-BP886153MO
- Images (0)
| Article Name: | Recombinant Mouse Prion-like protein doppel (Prnd) |
| Biozol Catalog Number: | CSB-BP886153MO |
| Supplier Catalog Number: | CSB-BP886153MO |
| Alternative Catalog Number: | CSB-BP886153MO-1, CSB-BP886153MO-100, CSB-BP886153MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Prnd, Prion-like protein doppel, Doppelganger, Dpl, PrPLP |
| Molecular Weight: | 18.9 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q9QUG3 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 27-155aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERG |
Product Guarantee and Expert Support
