Recombinant Arabidopsis thaliana Glucan endo-1,3-beta-glucosidase 10 (At5g42100)

Product Overview

• Article Name: Recombinant Arabidopsis thaliana Glucan endo-1,3-beta-glucosidase 10 (At5g42100)
• Biozol Catalog Number: CSB-BP887760DOA1
• Supplier Catalog Number: CSB-BP887760DOA1
• Alternative Catalog Number: CSB-BP887760DOA1-1, CSB-BP887760DOA1-100, CSB-BP887760DOA1-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: ((1->3)-beta-glucan endohydrolase 10)((1->3)-beta-glucanase 10)(Beta-1,3-endoglucanase 10)(Beta-1,3-glucanase 10)(Putative plasmodesmal associated protein)(AtBG_ppap)

Product Properties

• Molecular Weight: 71.5 kDa
• Tag: N-terminal 6xHis-EGFP-tagged
• UniProt: Q9FHX5
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Baculovirus
• Expression System: 27-425aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: IGINYGQVANNLPPPKNVIPLLKSVGATKVKLYDADPQALRAFAGSGFELTVALGNEYLAQMSDPIKAQGWVKENVQAYLPNTKIVAIVVGNEVLTSNQSALTAALFPAMQSIHGALVDCGLNKQIFVTTAHSLAILDVSYPPSATSFRRDLLGSLTPILDFHVKTGSPILINAYPFFAYEENPKHVSLDFVLFQPNQGFTDPGSNFHYDNMLFAQVDAVYHALDAVGISYKKVPIVVSETGWPSNGDPQEVGA