Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial
Catalog Number:
CSB-BP890933HU
- Images (0)
| Article Name: | Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial |
| Biozol Catalog Number: | CSB-BP890933HU |
| Supplier Catalog Number: | CSB-BP890933HU |
| Alternative Catalog Number: | CSB-BP890933HU-1, CSB-BP890933HU-100, CSB-BP890933HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | RING finger protein 203 Zinc/RING finger protein 3,CSB-PR2024 |
| Molecular Weight: | 23.8 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q9ULT6 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 56-219aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM |
Product Guarantee and Expert Support
