Recombinant Human Sal-like protein 4 (SALL4), partial
Catalog Number:
CSB-BP892126HU(M)
- Images (0)
| Article Name: | Recombinant Human Sal-like protein 4 (SALL4), partial |
| Biozol Catalog Number: | CSB-BP892126HU(M) |
| Supplier Catalog Number: | CSB-BP892126HU(M) |
| Alternative Catalog Number: | CSB-BP892126HU(M)-1, CSB-BP892126HU(M)-100, CSB-BP892126HU(M)-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Zinc finger protein 797 (Zinc finger protein SALL4) (ZNF797) |
| Molecular Weight: | 16.0 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q9UJQ4 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 954-1053aa+11R |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS |
Product Guarantee and Expert Support
