Recombinant Drosophila melanogaster Probable insulin-like peptide 7 (Ilp7)
Catalog Number:
CSB-BP895238DLU
- Images (0)
| Article Name: | Recombinant Drosophila melanogaster Probable insulin-like peptide 7 (Ilp7) |
| Biozol Catalog Number: | CSB-BP895238DLU |
| Supplier Catalog Number: | CSB-BP895238DLU |
| Alternative Catalog Number: | CSB-BP895238DLU-1, CSB-BP895238DLU-100, CSB-BP895238DLU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Insulin-related peptide 7,CSB-PR2024 |
| Molecular Weight: | 19.3 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q9W4Q9 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 32-159aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LQHTEEGLEMLFRERSQSDWENVWHQETHSRCRDKLVRQLYWACEKDIYRLTRRNKKRTGNDEAWIKKTTTEPDGSTWLHVNYANMFLRSRRSDGNTPSISNECCTKAGCTWEEYAEYCPSNKRRNHY |
Product Guarantee and Expert Support
