Recombinant rat Receptor-interacting serine/threonine-protein kinase 3 (Ripk3)

Catalog Number: CSB-BP897497RA
Article Name: Recombinant rat Receptor-interacting serine/threonine-protein kinase 3 (Ripk3)
Biozol Catalog Number: CSB-BP897497RA
Supplier Catalog Number: CSB-BP897497RA
Alternative Catalog Number: CSB-BP897497RA-1, CSB-BP897497RA-100, CSB-BP897497RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Homocysteine respondent protein HCYP2 (RIP-like protein kinase 3) (Receptor-interacting protein 3) (RIP-3) (Rip3)
Molecular Weight: 56.1 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q9Z2P5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Baculovirus
Expression System: 1-478aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSSVKLWLNGASSISLVGSEELENLGFVGKGGFGAVFRARHTAWNLDVAVKIVNSKKISREVKAMVNLRHENVLLLLGVTENLEWDYVYGPALVTGFMENGSLSGLLQPSCPRPWPLLCRLLEEVVLGMCYLHSLNPSLLHRDLKPSNVLLDPELHAKLADFGLSTFQGGSQSGSGSGSRDSGGTLAYLAPELLDNDGKASKASDVYSFGVLVWTVLAGREAEVVDKTSLIRGAVCNRQRRPPLTELPPDSPET