Recombinant rat Receptor-interacting serine/threonine-protein kinase 3 (Ripk3)
Catalog Number:
CSB-BP897497RA
- Images (0)
| Article Name: | Recombinant rat Receptor-interacting serine/threonine-protein kinase 3 (Ripk3) |
| Biozol Catalog Number: | CSB-BP897497RA |
| Supplier Catalog Number: | CSB-BP897497RA |
| Alternative Catalog Number: | CSB-BP897497RA-1, CSB-BP897497RA-100, CSB-BP897497RA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Homocysteine respondent protein HCYP2 (RIP-like protein kinase 3) (Receptor-interacting protein 3) (RIP-3) (Rip3) |
| Molecular Weight: | 56.1 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | Q9Z2P5 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Baculovirus |
| Expression System: | 1-478aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSSVKLWLNGASSISLVGSEELENLGFVGKGGFGAVFRARHTAWNLDVAVKIVNSKKISREVKAMVNLRHENVLLLLGVTENLEWDYVYGPALVTGFMENGSLSGLLQPSCPRPWPLLCRLLEEVVLGMCYLHSLNPSLLHRDLKPSNVLLDPELHAKLADFGLSTFQGGSQSGSGSGSRDSGGTLAYLAPELLDNDGKASKASDVYSFGVLVWTVLAGREAEVVDKTSLIRGAVCNRQRRPPLTELPPDSPET |
Product Guarantee and Expert Support
