Recombinant Human Adiponectin receptor protein 1 (ADIPOR1), partial
Catalog Number:
CSB-CF001367HU2
- Images (0)
| Article Name: | Recombinant Human Adiponectin receptor protein 1 (ADIPOR1), partial |
| Biozol Catalog Number: | CSB-CF001367HU2 |
| Supplier Catalog Number: | CSB-CF001367HU2 |
| Alternative Catalog Number: | CSB-CF001367HU2-100, CSB-CF001367HU2-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Progestin and adipoQ receptor family member 1 (Progestin and adipoQ receptor family member I) (PAQR1) (TESBP1A) |
| Molecular Weight: | 34.8 kDa |
| Tag: | N-terminal 6xHis-Flag-tagged |
| UniProt: | Q96A54 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 89-375aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHV |
Product Guarantee and Expert Support
